Structure of PDB 9c3u Chain D Binding Site BS03

Receptor Information
>9c3u Chain D (length=238) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HNRDFLTDAAHLPDSIDLIVADPPYGLGKDYGNDSDKRSGDDFLAWTREW
LELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIWDRRVPSMG
GTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARSRKLFEGSK
WLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLASCPPGGRV
LDPFMGSGTTAVACARQGRDFVGYEINEYCAIAHERVN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c3u Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		D59 P60 P61 Y62 T106 W107 S135 M136 G137 G138 T139 R142 S145 D148 R203 H205 R206 Q207 R211 P215 T216 K218
Binding residue
(residue number reindexed from 1)		D22 P23 P24 Y25 T69 W70 S98 M99 G100 G101 T102 R105 S108 D111 R166 H168 R169 Q170 R174 P178 T179 K181
External links