Structure of PDB 8pmv Chain D Binding Site BS03

Receptor Information
>8pmv Chain D (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKRQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pmv transcription factor BARHL2 bound to DNA sequences
Resolution2.1 Å
Binding residue
(original residue number in PDB)
H242 N245 R249
Binding residue
(residue number reindexed from 1)
H11 N14 R18
External links
PDB RCSB:8pmv, PDBe:8pmv, PDBj:8pmv
PDBsum8pmv
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]