Structure of PDB 8fc8 Chain D Binding Site BS03

Receptor Information
>8fc8 Chain D (length=617) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRPILFDIVSRGSTADLDGLLPFLLTHKKRLTDEEFREPSTGKTCLPKAL
LNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQTALHIAIERR
CKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPH
IVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLL
LLKCARLFPDSNLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDT
RHLSRKFKDWAYGPVYSSLYDLSSLDTCGEEASVLEILVYNSKIENRHEM
LAVEPINELLRDKWRKFGAVSFYINVVSYLCAMVIFTLTAYYQPLEGTPP
YPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMKKCPGVNSLFIDGSF
QLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLT
GTYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCDSETFSTFLL
DLFKLTIGMGDLEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGET
VGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGT
PDRRWCFRVDEVNWSHW
Ligand information
Ligand IDY01
InChIInChI=1S/C31H50O4/c1-20(2)7-6-8-21(3)25-11-12-26-24-10-9-22-19-23(35-29(34)14-13-28(32)33)15-17-30(22,4)27(24)16-18-31(25,26)5/h9,20-21,23-27H,6-8,10-19H2,1-5H3,(H,32,33)/t21-,23+,24+,25-,26+,27+,30+,31-/m1/s1
InChIKeyWLNARFZDISHUGS-MIXBDBMTSA-N
SMILES
SoftwareSMILES
CACTVS 3.352CC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC=C4C[C@H](CC[C@]4(C)[C@H]3CC[C@]12C)OC(=O)CCC(O)=O
OpenEye OEToolkits 1.6.1CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)OC(=O)CCC(=O)O)C)C
OpenEye OEToolkits 1.6.1CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3[C@H]2CC=C4[C@@]3(CC[C@@H](C4)OC(=O)CCC(=O)O)C)C
CACTVS 3.352CC(C)CCC[CH](C)[CH]1CC[CH]2[CH]3CC=C4C[CH](CC[C]4(C)[CH]3CC[C]12C)OC(=O)CCC(O)=O
FormulaC31 H50 O4
NameCHOLESTEROL HEMISUCCINATE
ChEMBL
DrugBank
ZINCZINC000058638837
PDB chain8fc8 Chain D Residue 1002 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fc8 TRPV4-Rho GTPase complex structures reveal mechanisms of gating and disease.
Resolution3.47 Å
Binding residue
(original residue number in PDB)		V693 I696 V700
Binding residue
(residue number reindexed from 1)		V522 I525 V529
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005034 osmosensor activity
GO:0005080 protein kinase C binding
GO:0005216 monoatomic ion channel activity
GO:0005261 monoatomic cation channel activity
GO:0005262 calcium channel activity
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0005524 ATP binding
GO:0008017 microtubule binding
GO:0008289 lipid binding
GO:0015275 stretch-activated, monoatomic cation-selective, calcium channel activity
GO:0019901 protein kinase binding
GO:0042169 SH2 domain binding
GO:0042802 identical protein binding
GO:0043014 alpha-tubulin binding
GO:0046872 metal ion binding
GO:0048487 beta-tubulin binding
GO:0051015 actin filament binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001666 response to hypoxia
GO:0002024 diet induced thermogenesis
GO:0006811 monoatomic ion transport
GO:0006816 calcium ion transport
GO:0006874 intracellular calcium ion homeostasis
GO:0006884 cell volume homeostasis
GO:0006970 response to osmotic stress
GO:0006971 hypotonic response
GO:0007015 actin filament organization
GO:0007043 cell-cell junction assembly
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007231 osmosensory signaling pathway
GO:0009612 response to mechanical stimulus
GO:0010628 positive regulation of gene expression
GO:0010759 positive regulation of macrophage chemotaxis
GO:0010977 negative regulation of neuron projection development
GO:0030036 actin cytoskeleton organization
GO:0030103 vasopressin secretion
GO:0031117 positive regulation of microtubule depolymerization
GO:0032755 positive regulation of interleukin-6 production
GO:0032868 response to insulin
GO:0034605 cellular response to heat
GO:0042538 hyperosmotic salinity response
GO:0042593 glucose homeostasis
GO:0043117 positive regulation of vascular permeability
GO:0043622 cortical microtubule organization
GO:0045989 positive regulation of striated muscle contraction
GO:0046330 positive regulation of JNK cascade
GO:0046785 microtubule polymerization
GO:0047484 regulation of response to osmotic stress
GO:0050729 positive regulation of inflammatory response
GO:0050891 multicellular organismal-level water homeostasis
GO:0055085 transmembrane transport
GO:0060351 cartilage development involved in endochondral bone morphogenesis
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070509 calcium ion import
GO:0070588 calcium ion transmembrane transport
GO:0071470 cellular response to osmotic stress
GO:0071476 cellular hypotonic response
GO:0071477 cellular hypotonic salinity response
GO:0071639 positive regulation of monocyte chemotactic protein-1 production
GO:0071642 positive regulation of macrophage inflammatory protein 1 alpha production
GO:0071651 positive regulation of chemokine (C-C motif) ligand 5 production
GO:0097009 energy homeostasis
GO:0097497 blood vessel endothelial cell delamination
GO:1902656 calcium ion import into cytosol
GO:1903444 negative regulation of brown fat cell differentiation
GO:1903715 regulation of aerobic respiration
GO:2000340 positive regulation of chemokine (C-X-C motif) ligand 1 production
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005881 cytoplasmic microtubule
GO:0005886 plasma membrane
GO:0005912 adherens junction
GO:0005925 focal adhesion
GO:0005929 cilium
GO:0009986 cell surface
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0030426 growth cone
GO:0030864 cortical actin cytoskeleton
GO:0032587 ruffle membrane
GO:0070161 anchoring junction

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fc8, PDBe:8fc8, PDBj:8fc8
PDBsum8fc8
PubMed37353484
UniProtQ9HBA0|TRPV4_HUMAN Transient receptor potential cation channel subfamily V member 4 (Gene Name=TRPV4)

[Back to BioLiP]