Structure of PDB 7vvz Chain D Binding Site BS03

Receptor Information
>7vvz Chain D (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>7vvz Chain X (length=9) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FRHRKISVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vvz Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
Resolution8.8 Å
Binding residue
(original residue number in PDB)		L106 H109
Binding residue
(residue number reindexed from 1)		L75 H78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7vvz, PDBe:7vvz, PDBj:7vvz
PDBsum7vvz
PubMed36198799
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]