Structure of PDB 7b9v Chain D Binding Site BS03

Receptor Information
>7b9v Chain D (length=194) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRNYSIDETLQRLVREKEMEQNEDKMDLLEKRLAKIQQE
QEDDEELENLRKKNLEMSQRAEMINRSAAAAAAAAAAAAAAAAA
Ligand information
>7b9v Chain I (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaugucuaaaguuaugugcucuuauuuacuaacaaaaucaacaugcuau
ugaac
..................................................
.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b9v Structural basis for conformational equilibrium of the catalytic spliceosome.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R4 K22 S37 H38 I41 R42 K68 L70 K80 Y82
Binding residue
(residue number reindexed from 1)		R3 K21 S36 H37 I40 R41 K67 L69 K79 Y81
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 15:58:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7b9v', asym_id = 'D', bs = 'BS03', title = 'Structural basis for conformational equilibrium of the catalytic spliceosome.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7b9v', asym_id='D', bs='BS03', title='Structural basis for conformational equilibrium of the catalytic spliceosome.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000398', uniprot = '', pdbid = '7b9v', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000398', uniprot='', pdbid='7b9v', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>