Structure of PDB 6el8 Chain D Binding Site BS03

Receptor Information
>6el8 Chain D (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMPKPIYSYSILIFMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKN
SVRHNLSLNKCFEKVEKGCLWALNPAKIDKMQEELQKWK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6el8 Crystal structure of the Forkhead domain of human FOXN1 in complex with DNA
Resolution1.61 Å
Binding residue
(original residue number in PDB)		K271 Y276 N317 S318
Binding residue
(residue number reindexed from 1)		K4 Y9 N50 S51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6el8, PDBe:6el8, PDBj:6el8
PDBsum6el8
PubMed
UniProtO15353|FOXN1_HUMAN Forkhead box protein N1 (Gene Name=FOXN1)

[Back to BioLiP]