Structure of PDB 5lj5 Chain D Binding Site BS03

Receptor Information

>5lj5 Chain D (length=114) Species: 4932 (Saccharomyces cerevisiae)

SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRN

Ligand information

>5lj5 Chain Z (length=171)

gaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuguaa
caacugaaaugaccuaggcucauuguuacaauacacauuuuuuggggacg
ggaagaggagacgucgcgacccucgcagagucguucuugacuuggucgcu
ugauguuucuucuucccguuc

.............................................<<<<<
<<<......<<<<<<>>>.>>>>>>>>>>>...............<<<<<
<<<<<<.<<<<<<<<<<<<.<<.....<<<<<<....>>>>>>>>>>>>.
.>>>>>>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5lj5 Cryo-EM structure of the spliceosome immediately after branching.
• Resolution: 10.0 Å
• Binding residue (original residue number in PDB): R4 K9 R25
• Binding residue (residue number reindexed from 1): R3 K8 R24

Gene Ontology

Molecular Function

• GO:0000384 first spliceosomal transesterification activity
• GO:0005515 protein binding
• GO:0030620 U2 snRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000349 generation of catalytic spliceosome for first transesterification step
• GO:0000350 generation of catalytic spliceosome for second transesterification step
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
• PDBsum: 5lj5
• PubMed: 27459055
• UniProt: P28320|YJU2_YEAST Splicing factor YJU2 (Gene Name=YJU2)