Structure of PDB 5btc Chain D Binding Site BS03

Receptor Information

>5btc Chain D (length=247) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NALVRRKSGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIV
LMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDP
EFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDP
SVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV

Ligand information

>5btc Chain G (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acgtgcatagtcattcatgac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5btc Crystal structure and stability of gyrase-fluoroquinolone cleaved complexes from Mycobacterium tuberculosis.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	K484 I486 N487 K490 R495 N499 H539 V656 R659
Binding residue (residue number reindexed from 1)	K56 I58 N59 K62 R67 N71 H111 V228 R231

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5btc, PDBe:5btc, PDBj:5btc
PDBsum	5btc
PubMed	26792525
UniProt	P9WG45\|GYRB_MYCTU DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]