Structure of PDB 4rdu Chain D Binding Site BS03

Receptor Information
>4rdu Chain D (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQ
NKRSKIKKIMKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rdu Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
Resolution1.85 Å
Binding residue
(original residue number in PDB)		R138 K139 R141 T142 Y144 I183 N187 K191
Binding residue
(residue number reindexed from 1)		R2 K3 R5 T6 Y8 I47 N51 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rdu, PDBe:4rdu, PDBj:4rdu
PDBsum4rdu
PubMed
UniProtP56178|DLX5_HUMAN Homeobox protein DLX-5 (Gene Name=DLX5)

[Back to BioLiP]