Structure of PDB 4kpf Chain D Binding Site BS03

Receptor Information

>4kpf Chain D (length=210) Species: 170187 (Streptococcus pneumoniae TIGR4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAK
AKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHI
QTLLLTFFYRYMRPLVEAGHVYIALPPLYKMAYAWTDGELEELRKQLQRY
KGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRR
KWIEDNVKFT

Ligand information

>4kpf Chain H (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gactatgcacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4kpf Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
Resolution	3.24 Å
Binding residue (original residue number in PDB)	K458 N461 K464 H513 V626 R629
Binding residue (residue number reindexed from 1)	K44 N47 K50 H99 V196 R199

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4kpf, PDBe:4kpf, PDBj:4kpf
PDBsum	4kpf
PubMed	27655731
UniProt	Q59961\|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]