Structure of PDB 3v21 Chain D Binding Site BS03

Receptor Information

>3v21 Chain D (length=289) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLTNSNCVEEYKENGKTKIRIKPFNALIELYHHQTPTGSIKENLDKLENY
VKDVVKAKGLAIPTSGAFSNTRGTWFEVMIAIQSWNYRVKRELNDYLIIK
MPNVKTFDFRKIFDNETREKLHQLEKSLLTHKQQVRLITSNPDLLIIRQK
DLIKSEYNLPINKLTHENIDVALTLFKDIEGKCKWDSLVAGVGLKTSLRP
DRRLQLVHEGNILKSLFAHLKMAYWNPKAEFKYYGASSEPVSKADDDALQ
TAATHTIVNVNSTPERAVDDIFSLTSFEDIDKMLDQIIK

Ligand information

>3v21 Chain V (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttcgaccggtcga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3v21 Structural mechanisms of the degenerate sequence recognition by Bse634I restriction endonuclease.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	K129 T133
Binding residue (residue number reindexed from 1)	K126 T130

Enzymatic activity

Catalytic site (original residue number in PDB)	E80 D146 K198 E212
Catalytic site (residue number reindexed from 1)	E77 D143 K195 E209
Enzyme Commision number	3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3v21, PDBe:3v21, PDBj:3v21
PDBsum	3v21
PubMed	22495930
UniProt	Q8RT53

[Back to BioLiP]