Structure of PDB 3r93 Chain D Binding Site BS03

Receptor Information
>3r93 Chain D (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLE
FRKKIAENK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r93 Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
Resolution2.057 Å
Binding residue
(original residue number in PDB)		D57 V58 F59 E60 V61 W80 Y83 E91 H95 D98 C99 E101 V102
Binding residue
(residue number reindexed from 1)		D2 V3 F4 E5 V6 W25 Y28 E36 H40 D43 C44 E46 V47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3r93, PDBe:3r93, PDBj:3r93
PDBsum3r93
PubMed22022377
UniProtQ99549|MPP8_HUMAN M-phase phosphoprotein 8 (Gene Name=MPHOSPH8)

[Back to BioLiP]