Structure of PDB 3k9f Chain D Binding Site BS03

Receptor Information

>3k9f Chain D (length=222) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAK
AKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTL
LLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELR
KQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRV
NVLMGDKVEPRRKWIEDNVKFT

Ligand information

>3k9f Chain H (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gactatgcacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3k9f Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
Resolution	2.9 Å
Binding residue (original residue number in PDB)	K458 N461 K464 H513 V626 R629 R630
Binding residue (residue number reindexed from 1)	K44 N47 K50 H96 V208 R211 R212

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3k9f, PDBe:3k9f, PDBj:3k9f
PDBsum	3k9f
PubMed	20596531
UniProt	Q59961\|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]