Structure of PDB 3imb Chain D Binding Site BS03

Receptor Information
>3imb Chain D (length=238) Species: 54910 (Brevibacillus centrosporus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENN
ITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPSS
RNPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNL
SKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMD
LCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3imb Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA
Resolution1.89 Å
Binding residue
(original residue number in PDB)		D33 G34 G37 Q38 N49 N50 I51 E60 K62 G63 M64 R65 R67 S71 T74 H77 K78 K79 K152 D215 R216 G217 H219 R221
Binding residue
(residue number reindexed from 1)		D33 G34 G37 Q38 N49 N50 I51 E60 K62 G63 M64 R65 R67 S71 T74 H77 K78 K79 K152 D215 R216 G217 H219 R221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3imb, PDBe:3imb, PDBj:3imb
PDBsum3imb
PubMed
UniProtQ8RNV8

[Back to BioLiP]