Structure of PDB 2ivk Chain D Binding Site BS03

Receptor Information

>2ivk Chain D (length=210) Species: 672 (Vibrio vulnificus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APPSSFSAAKQQAVKIYQDHPISFYCGCDIEWQGKKGIPNLETCGYQVRK
QQTRASRIEWEAVVPAWQFGHHRQCWQKGGRKNCSKNDQQFRLMEADLHN
LTPAIGEVNGDRSNFNFSQWNGVDGVSYGRCEMQVNFKQRKVMPPDRARG
SIARTYLYMSQEYGFQLSKQQQQLMQAWNKSYPVDEWECTRDDRIAKIQG
NHNPFVQQSC

Ligand information

>2ivk Chain H (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aattcgatcgaattc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ivk Structural Basis for Sequence-Dependent DNA Cleavage by Nonspecific Endonucleases.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	S25 R67 K68 Q69 K104 F155 K156
Binding residue (residue number reindexed from 1)	S7 R49 K50 Q51 K86 F137 K138

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004518	nuclease activity
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2ivk, PDBe:2ivk, PDBj:2ivk
PDBsum	2ivk
PubMed	17175542
UniProt	Q7MHK3

[Back to BioLiP]