Structure of PDB 4u4q Chain C5 Binding Site BS03

Receptor Information

>4u4q Chain C5 (length=124) Species: 559292 (Saccharomyces cerevisiae S288C)

KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM
KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI
RPEMLGHYLGEFSITYTPVRHGRA

Ligand information

• Ligand ID: OHX
• InChI: InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6
• InChIKey: OWCQTVJQFLTQTE-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01
  CACTVS 3.370
  OpenEye OEToolkits 1.7.0: N[Os](N)(N)(N)(N)N
• Formula: H12 N6 Os
• Name: osmium (III) hexammine;
  osmium(6+) hexaazanide
• PDB chain: 4u4q Chain C5 Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4u4q ?
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): L65 A67 E69
• Binding residue (residue number reindexed from 1): L58 A60 E62
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u4q, PDBe:4u4q, PDBj:4u4q
• PDBsum: 4u4q
• PubMed: 25209664
• UniProt: Q01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)