Structure of PDB 9gd3 Chain C Binding Site BS03

Receptor Information
>9gd3 Chain C (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
Ligand information
>9gd3 Chain T (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTRFSNRQNKTVNYNIDYSDDDLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9gd3 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		E56 Y57 E61 A69 D72 N73 N89 D90 E92
Binding residue
(residue number reindexed from 1)		E42 Y43 E47 A55 D58 N59 N75 D76 E78
External links
PDB RCSB:9gd3, PDBe:9gd3, PDBj:9gd3
PDBsum9gd3
PubMed39270644
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]