Structure of PDB 9fh9 Chain C Binding Site BS03

Receptor Information
>9fh9 Chain C (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL
AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVL
LP
Ligand information
>9fh9 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fh9 Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R29 R42 V43 G44 K75 T76
Binding residue
(residue number reindexed from 1)		R14 R27 V28 G29 K60 T61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006337 nucleosome disassembly
GO:0031507 heterochromatin formation
GO:0070914 UV-damage excision repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fh9, PDBe:9fh9, PDBj:9fh9
PDBsum9fh9
PubMed39143240
UniProtQ7L7L0|H2A3_HUMAN Histone H2A type 3 (Gene Name=H2AC25)

[Back to BioLiP]