Structure of PDB 9fgq Chain C Binding Site BS03

Receptor Information
>9fgq Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN
IQAVLLP
Ligand information
>9fgq Chain J (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggatgtatatatctgacacgtgcctggagactagggagtaatccccttg
gcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fgq Spatial control of the APC/C ensures the rapid degradation of Cyclin B1
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R11 R42 V43 T76 R77
Binding residue
(residue number reindexed from 1)		R1 R32 V33 T66 R67
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fgq, PDBe:9fgq, PDBj:9fgq
PDBsum9fgq
PubMed39143240
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]