Structure of PDB 8ihm Chain C Binding Site BS03

Receptor Information
>8ihm Chain C (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
Ligand information
>8ihm Chain M (length=18) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRKIITSEGIERSFKNEH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ihm Structural basis for nucleosome binding and catalysis by the yeast Rpd3S/HDAC holoenzyme.
Resolution3.58 Å
Binding residue
(original residue number in PDB)		A60 A69 D72 N73 R81 N89 D90 E91 E92 P109
Binding residue
(residue number reindexed from 1)		A49 A58 D61 N62 R70 N78 D79 E80 E81 P98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ihm, PDBe:8ihm, PDBj:8ihm
PDBsum8ihm
PubMed37845487
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]