Structure of PDB 8bpa Chain C Binding Site BS03

Receptor Information

>8bpa Chain C (length=213) Species: 9606 (Homo sapiens)

SGGLMEQIQALLAPPKTDDSCDSCKEGGDLLCCDHCPAAFHLQCCNPPLS
EEMLPPGEWMCHRCTVRRKKREQKPQLRRPFELLIAAAMERNPTQFQLPN
ELTCTTQHELDHNGLVPLPVKVCFTCNRSCRVAPLIQCDYCPLLFHMDCL
EPPLTAMPLGRWMCPNHIEHVVLNQKNMTLSNRCQVFDRFQDTVSQHVVK
VDFLNRIHKKHPP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8bpa Chain C Residue 1103

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8bpa Mechanism of assembly, activation and lysine selection by the SIN3B histone deacetylase complex
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): C71 C74 C99 C102
• Binding residue (residue number reindexed from 1): C33 C36 C61 C64
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0001222 transcription corepressor binding
• GO:0003714 transcription corepressor activity
• GO:0005515 protein binding
• GO:0035091 phosphatidylinositol binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0017053 transcription repressor complex
• GO:0070822 Sin3-type complex

External links

• PDB: RCSB:8bpa, PDBe:8bpa, PDBj:8bpa
• PDBsum: 8bpa
• PubMed: 37137925
• UniProt: Q96QT6|PHF12_HUMAN PHD finger protein 12 (Gene Name=PHF12)