Structure of PDB 7wm3 Chain C Binding Site BS03

Receptor Information
>7wm3 Chain C (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHD
PVDKIVLQKYHTINGHNAEVRKALSRQEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wm3 Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		K17 E18 Q172 K173 Y174 N181
Binding residue
(residue number reindexed from 1)		K3 E4 Q158 K159 Y160 N167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7wm3, PDBe:7wm3, PDBj:7wm3
PDBsum7wm3
PubMed36528084
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]