Structure of PDB 7rva Chain C Binding Site BS03

Receptor Information

>7rva Chain C (length=221) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAK
YAEIFGLTSAEASKDIRQALKSFAGKEVVFYRYESFPWFIKPAHSPSRGL
YSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPD
GSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSY
IEKKKGRQTTHIVFSFRDITS

Ligand information

>7rva Chain D (length=3) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7rva Towards automated crystallographic structure refinement with phenix.refine.
Resolution	1.89 Å
Binding residue (original residue number in PDB)	R12 R150 P175
Binding residue (residue number reindexed from 1)	R2 R124 P149

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7rva, PDBe:7rva, PDBj:7rva
PDBsum	7rva
PubMed
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]