Structure of PDB 6zhx Chain C Binding Site BS03

Receptor Information
>6zhx Chain C (length=110) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP
NIQSVLLPKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zhx Mechanistic Insights into Regulation of the ALC1 Remodeler by the Nucleosome Acidic Patch.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y57 E61 E64 D90 E92
Binding residue
(residue number reindexed from 1)		Y48 E52 E55 D81 E83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6zhx, PDBe:6zhx, PDBj:6zhx
PDBsum6zhx
PubMed33357431
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]