Structure of PDB 5w3v Chain C Binding Site BS03

Receptor Information

>5w3v Chain C (length=184) Species: 9545 (Macaca nemestrina)

ALLTAKTFSLQFNNKRRVNKPYYPRKALLCYQLTPQNGSTPTRGHLINKK
EDHAEIRFINEIKSMGLDETQDYQVTCYLTWSPCPSCAGELVDFIKAHRH
LNLRIFASRLYYHWHPNYQEGLLLLCGSQVPVEVMGLPEFTDCWENFVDH
KEPPSFNPSEKLKELDKNSQAIKRRLERIKSRSV

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5w3v Chain C Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5w3v APOBEC3H structure reveals an unusual mechanism of interaction with duplex RNA.
• Resolution: 2.243 Å
• Binding residue (original residue number in PDB): H54 C85 C88
• Binding residue (residue number reindexed from 1): H53 C84 C87
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0016554 cytidine to uridine editing
• GO:0045087 innate immune response
• GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
• GO:0051607 defense response to virus
• GO:0070383 DNA cytosine deamination

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:5w3v, PDBe:5w3v, PDBj:5w3v
• PDBsum: 5w3v
• PubMed: 29044109
• UniProt: A0A1B2AH37