Structure of PDB 4auv Chain C Binding Site BS03

Receptor Information
>4auv Chain C (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEDYERRRSECVSEMLDLEKQFSELKEKLFRERLS
Ligand information
>4auv Chain H (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SECVSEMLDLEKQFSELKEKLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4auv Brms151-98 and Brms151-84 are Crystal Oligomeric Coiled Coils with Different Oligomerization States, which Behave as Disordered Protein Fragments in Solution.
Resolution1.999 Å
Binding residue
(original residue number in PDB)		C60 E63 M64 D66 L67 Q70 F71 L74
Binding residue
(residue number reindexed from 1)		C11 E14 M15 D17 L18 Q21 F22 L25
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4auv, PDBe:4auv, PDBj:4auv
PDBsum4auv
PubMed23500495
UniProtQ9HCU9|BRMS1_HUMAN Breast cancer metastasis-suppressor 1 (Gene Name=BRMS1)

[Back to BioLiP]