Structure of PDB 3bim Chain C Binding Site BS03

Receptor Information
>3bim Chain C (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACS
GLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMA
VMATAMYLQMEHVVDTCRKFIKASE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bim Structure of a BCOR corepressor peptide in complex with the BCL6 BTB domain dimer.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
T62 Q64
Binding residue
(residue number reindexed from 1)
T58 Q60
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3bim, PDBe:3bim, PDBj:3bim
PDBsum3bim
PubMed18280243
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]