Structure of PDB 2wqj Chain C Binding Site BS03

Receptor Information
>2wqj Chain C (length=32) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDEDTYYLQVRGRENFEILMKLKESLELMEL
Ligand information
>2wqj Chain L (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TYYLQVRGRENFEILMKLKESLELME
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wqj Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y355 Q358
Binding residue
(residue number reindexed from 1)		Y7 Q10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wqj, PDBe:2wqj, PDBj:2wqj
PDBsum2wqj
PubMed19815500
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]