Structure of PDB 8ova Chain Bu Binding Site BS03

Receptor Information
>8ova Chain Bu (length=247) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVKNKAYYKRFQVKYRRRREGKTDYHARRRMVLQDKTKFGTPKYRLVVR
ITNRDVIAQIVHAKVVGDEVVMAAYSHELPLFGIEHGLTNYAAAYATGLL
VARRMLAKLGLAEKFVGVKEVDGSYAAVRTKDDDQGDDESRFPFKAILDV
GLARTTTGARVFGVLKGAVDGGLAVPHRPNRFPGYNKESDALNAKVHRDR
IFGRHVADYLKQVREEASSNVSPDDMEGMYKRAHAAIRADPTKRRAK
Ligand information
>8ova Chain BD (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggguacgaccauacuuggccgaaugcaccauaucccguccgauuugugaa
guuaagcggccacaggccucguuaguacggcgaucagugauggcgcugga
acccgggguguuguacucu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		K10 Y13 V18 Y20 R21 R22 R24 Y30 R33 R54 T56 N57 R58 Q63 V69 D72 V74 Y79 N94 Y95 R158 R164 R204 V210 Y213 Q216
Binding residue
(residue number reindexed from 1)		K6 Y9 V14 Y16 R17 R18 R20 Y26 R29 R50 T52 N53 R54 Q59 V65 D68 V70 Y75 N90 Y91 R154 R160 R200 V206 Y209 Q212
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0042255 ribosome assembly
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ38CY8

[Back to BioLiP]