Structure of PDB 4v8m Chain Bu Binding Site BS03

Receptor Information
>4v8m Chain Bu (length=298) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVKVVKNKAYYKRFQVKYRRRREGKTDYHARRRMVLQDKTKFGTPKYRL
VVRITNRDVIAQIVHAKVVGDEVVMAAYSHELPLFGIEHGLTNYAAAYAT
GLLVARRMLAKLGLAEKFVGVKEVDGSYAAVRTKDDDQGDDESRFPFKAI
LDVGLARTTTGARVFGVLKGAVDGGLAVPHRPNRFPGYNKESDALNAKVH
RDRIFGRHVADYLKQVREEASSNPDEKTCQFSKFIAAKVSPDDMEGMYKR
AHAAIRADPTKRRAKKERPAEAKPKKYNTVKLTGAEKKAAAKAKVAAV
Ligand information
>4v8m Chain BD (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggguacgaccauacuuggccgaaugcaccauaucccguccgauuugugaa
guuaagcggccacaggccucguuaguacggcgaucagugauggcgcugga
acccgggguguuguacucu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<.<<<....>>>>>>>>..
...>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
Resolution5.57 Å
Binding residue
(original residue number in PDB)		N9 Y13 V18 Y20 R21 R22 R24 Y30 R33 R50 V52 R54 T56 N57 R58 Q63 K68 V70 G71 D72 E73 V74 Y79 T93 N94 Y95 L156 R158 T160 T161 G162 R164 R204 H209 Y213 Q216 Q231 F232 S233 K234 F235 A265 K266 E268 R269 P270 A271 E272 K274 P275 K276 Y278 N279 T280 V281 K282 L283 K288 K289
Binding residue
(residue number reindexed from 1)		N8 Y12 V17 Y19 R20 R21 R23 Y29 R32 R49 V51 R53 T55 N56 R57 Q62 K67 V69 G70 D71 E72 V73 Y78 T92 N93 Y94 L155 R157 T159 T160 G161 R163 R203 H208 Y212 Q215 Q230 F231 S232 K233 F234 A264 K265 E267 R268 P269 A270 E271 K273 P274 K275 Y277 N278 T279 V280 K281 L282 K287 K288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0042255 ribosome assembly
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum4v8m
PubMed23395961
UniProtQ38CY8

[Back to BioLiP]