Structure of PDB 4v8m Chain Bs Binding Site BS03

Receptor Information

>4v8m Chain Bs (length=52) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VMEPTLEALAKKYNWEKKVCRRCYARLPVRATNCRKKGCGHCSNLRMKKK
LR

Ligand information

>4v8m Chain BG (length=182) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gugagauugugaagggaucucgcaggcaucgugagggaaguaugggguag
uacgagaggaacucccaugccgugccucugguuucuggaguuugucgaag
ggcaagugcuccgacgcuaucgcacggugguucucggcugaacgccucua
agccagaaaccagucccaagaccgggugcccg

...<<<<<.......>>>>>....<<<<<<....<<<..<<<<<<<<...
............>>>>>>>><<<<....<<<<....<<<<<<<<<.....
.>>>>..>>>>>...>>>>...>>>>.<<<<....<<<<...........
>>>>....>>>>..>>>.......>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
Resolution	5.57 Å
Binding residue (original residue number in PDB)	R26 R30 R35 K36
Binding residue (residue number reindexed from 1)	R26 R30 R35 K36

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0031386	protein tag activity
GO:0031625	ubiquitin protein ligase binding

	Biological Process
GO:0006412	translation
GO:0016567	protein ubiquitination
GO:0019941	modification-dependent protein catabolic process

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum	4v8m
PubMed	23395961
UniProt	P21899\|RL40_TRYBB Ubiquitin-ribosomal protein eL40 fusion protein

[Back to BioLiP]