Structure of PDB 8ove Chain Bo Binding Site BS03

Receptor Information
>8ove Chain Bo (length=89) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKRTVKMGVMGRYGARYGSNPRKRAKKLEVSQHAKHFCSFCGKFAFRRKA
VGIWRCDGCSKTVAGGAYTLSTPNNTTVRSTVRRLRELK
Ligand information
>8ove Chain BE (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaugcgcuugccaggugacccauccauccucccacggugagcuuu
cuuuucaccauaauccaccuugggccucucgacgcguuacucggagcggg
ggcucaagauugaaaaaugcagcacugucugugaguucggcgcauuaaag
caaaaaccuggggugu
<<<....>>>..<..<<<<<<.......<<...<<<.<<.<<<<<<....
...>>>>>><...<<.<.<<<<<<<<<<<...<<.......>>....>>>
>>>>>>>>.>.>>....><<<<..>>>>.>>.>>>...>>..........
.....>>>>>>.>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R13 E30 H34 C42 R49 A51 Y69
Binding residue
(residue number reindexed from 1)		R12 E29 H33 C41 R48 A50 Y68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38AW9

[Back to BioLiP]