Structure of PDB 4v5z Chain Bn Binding Site BS03

Receptor Information
>4v5z Chain Bn (length=236) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI
ICQIAYARIEGDMIVCARYAHELPKYGVKVGLTNYAAAYCTGLLLARRLL
NRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVF
GALKGAVDGGLSIPHSTKRFPGYDSESKEFAEVHRKHIMGQNVADYMRYL
MEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAI
Ligand information
>4v5z Chain BY (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuacggcauaccacccugaacgcgcccgaucucgucugaucucggaagc
uaagcagggucgggccuggagaguacuuggugggagaccgccugggaaua
ccgggucuguaguuu
.<<<<<...([<<<<<<<<....<<<<<<<..<......>..>>>>..>>
...>>>>>>>.>><<<<<<....<..<.<<<<<....>>>>>.>..)>].
>>>>>>.>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
Resolution8.7 Å
Binding residue
(original residue number in PDB)		Y11 F12 K13 Q16 V17 K18 F19 R21 T27 R53 N56 R57 H80 K196 D216 Y218 K219
Binding residue
(residue number reindexed from 1)		Y2 F3 K4 Q7 V8 K9 F10 R12 T18 R44 N47 R48 H71 K186 D206 Y208 K209
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 01:39:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v5z', asym_id = 'Bn', bs = 'BS03', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v5z', asym_id='Bn', bs='BS03', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '4v5z', asym_id = 'Bn'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='4v5z', asym_id='Bn')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>