Structure of PDB 9f1b Chain Bl Binding Site BS03

Receptor Information
>9f1b Chain Bl (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>9f1b Chain BK (length=29) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9f1b NAC guides a ribosomal multienzyme complex for nascent protein processing.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		W28 Y37
Binding residue
(residue number reindexed from 1)		W27 Y36
External links