Structure of PDB 8ova Chain Bl Binding Site BS03

Receptor Information
>8ova Chain Bl (length=144) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFSGSVAANRSKKIHQLTKKTTRVKRDRKSPRLYMKGTLAGYTRGLHGQN
KNTALVRIENVNTTEDAKWYVGKRVCYVYHGYKIKRCVRWSKAPARRSNT
RAIWGRITRPHGTSGTVRVKFNGSSVPASAIGRRIRVYLYPSRI
Ligand information
>8ova Chain BF (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgaaucgccacuucucuuauccggugggcugcccgcccggcgcccagua
ccuucauuuucacaagauc
.......<<<.............<<<<<<<.>>>>>>>.>>>........
...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		R28 K30 R31 D32 R33 K34 S35 P36 R37 V83 H85 R94 R101 S103 N104 T105 A107 W109 R139 R141
Binding residue
(residue number reindexed from 1)		R23 K25 R26 D27 R28 K29 S30 P31 R32 V78 H80 R89 R96 S98 N99 T100 A102 W104 R134 R136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ584G9

[Back to BioLiP]