Structure of PDB 8ove Chain Bj Binding Site BS03

Receptor Information

>8ove Chain Bj (length=116) Species: 5702 (Trypanosoma brucei brucei)

CPRVQYRRRMHYATRGNRMRLVRTPGNRLVMQKRGKRSQGPHTPWVLGHK
RLAGTKALRHTKARLAPRHQKTTSRPYGGVLSHEQVRDRIVRAFLIEEQR
IVKRALKAHAKVQKEK

Ligand information

>8ove Chain BE (length=166)

guggaaaugcgcuugccaggugacccauccauccucccacggugagcuuu
cuuuucaccauaauccaccuugggccucucgacgcguuacucggagcggg
ggcucaagauugaaaaaugcagcacugucugugaguucggcgcauuaaag
caaaaaccuggggugu

<<<....>>>..<..<<<<<<.......<<...<<<.<<.<<<<<<....
...>>>>>><...<<.<.<<<<<<<<<<<...<<.......>>....>>>
>>>>>>>>.>.>>....><<<<..>>>>.>>.>>>...>>..........
.....>>>>>>.>...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): C3 R17 L23 R25 P27 L31 R36 R39 S40 Q41 G42 H44 P46 W47 H51 R53 G56 T57 R70 K73 S76 R77 Y79 G81 V82 H85
• Binding residue (residue number reindexed from 1): C1 R15 L21 R23 P25 L29 R34 R37 S38 Q39 G40 H42 P44 W45 H49 R51 G54 T55 R68 K71 S74 R75 Y77 G79 V80 H83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: Q383V6