Structure of PDB 8ove Chain Bh Binding Site BS03

Receptor Information

>8ove Chain Bh (length=147) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAEARKSRDDRRWKRVLAKMDKYHGVGNTRVRGCTRASLFKRTGRKPDNI
VMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTF
IWHKGVKGVPGRVRVRVERKSETRKHFYTVISHIPVPSFKNLTTKVI

Ligand information

>8ove Chain BG (length=183) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gugagauugugaagggaucucgcaggcaucgugagggaaguaugggguag
uacgagaggaacucccaugccgugccucugguuucuggaguuugucgaag
ggcaagugcuccgacgcuaucgcacggugguucucggcugaacgccucua
agccagaaaccagucccaagaccgggugcccgu

<<<<<<<.........>>>>>>>.<<<<<<....<<<<.<<<<<<<<...
............>>>>>>>><<<<<...<<<<....<<<<<<<<<.....
.>>>>..>>>>>...>>>>..>>>>>.<<<<..<.<<<<...........
>>>>.>..>>>>.>>>>.......>>>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	K98 R99 F101 R104 K138 K141
Binding residue (residue number reindexed from 1)	K64 R65 F67 R70 K104 K107

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q38DH8

[Back to BioLiP]