Structure of PDB 8ova Chain Bh Binding Site BS03

Receptor Information

>8ova Chain Bh (length=156) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAEARKSRDDRRWKRVLAKMDPEKRKKYHGVGNTAEHSRVRGCTRASLFK
RTGRKPDNIVMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDN
RIDASLNTFIWHKGVKGVPGRVRVRVERKSETRKHFYTVISHIPVPSFKN
LTTKVI

Ligand information

>8ova Chain BH (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugucccucuccaaacgagaguacaugcaugggcuggcaugagcggcacgc
ucggggcucgaggggcaccgucccgaggcgcugaaccuugaugcuuggaa
uuucaugcucagggacuuu

.<<<<<.<<<.......>>>.....<<<<<<<<.<<.....<<<....<.
<....>.>....<<<......>>>....>>>....>>.....>>>.....
...>>>>>...>>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution	2.47 Å
Binding residue (original residue number in PDB)	H54 S63 R64 R66 T69 R70 A71 F74 R76 T77 K80 S89 H91 S93 K94 K97 K118 K121 R146 K179 L181
Binding residue (residue number reindexed from 1)	H29 S38 R39 R41 T44 R45 A46 F49 R51 T52 K55 S64 H66 S68 K69 K72 K93 K96 R121 K149 L151

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q38DH8

[Back to BioLiP]