Structure of PDB 8ova Chain BX Binding Site BS03

Receptor Information
>8ova Chain BX (length=120) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKRKAYTRPQFRRPHTYRRPATVKPSSNVSAIKNKWDAFRIIRYPLTTDK
AMKKIEENNTLTFIVDSRANKTEIKKAIRKLYQVKTVKVNTLIRPDGLKK
AYIRLSASYDALDTANKMGL
Ligand information
>8ova Chain BC (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagaaauugcccaaucuuugaacgc
aaacggcgcaugggagaagcucgagccauccccgugcaugccacauuucu
cagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>......>>>>.)...>>>....<<
.....>><<<<<<<....<<<..>>>....>>>>>>>.............
..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		T59 S69 N77 K78 S110 R111 E116 K119 R122 K128 T129
Binding residue
(residue number reindexed from 1)		T16 S26 N34 K35 S67 R68 E73 K76 R79 K85 T86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtP41165|RL23A_TRYBB Large ribosomal subunit protein uL23 (Gene Name=RPL23A)

[Back to BioLiP]