Structure of PDB 8ove Chain BR Binding Site BS03

Receptor Information

>8ove Chain BR (length=150) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YSRKPQVSSKTAKAKIADLRCHYKNTFETANVINGMKLRKAQQLYRQVLA
KTRCIPFKRYNGKIGNTAQAKEWGQTKGRWPRKSVVAMLSLLKNAEANAI
EKGLDPGKMVIKHVQVDQAPRVRRRTFRAHGRITPYMRSPCHVQLFMTQP

Ligand information

>8ove Chain BC (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagaaucauugcccaaucuuugaac
gcaaacggcgcaugggagaagcucgagccauccccgugcaugccacauuu
cucagugucg

.........................................<<<<<<<<<
....>>>>.....(<<<<......>>........>>>>.)...>>>....
<<.....>><<<<<<<....<<<..>>>....>>>>>>>...........
..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	S5 D120
Binding residue (residue number reindexed from 1)	S2 D117

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q385T6

[Back to BioLiP]