Structure of PDB 8ove Chain BO Binding Site BS03

Receptor Information
>8ove Chain BO (length=221) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLPSRRSLNRSSRKGFKKHRPDIIVIDLKDHVLGRAAAIVAKQLLLGKKI
TVVRCEKLTIAGSEIRNKIKYLQFLRKRKLSNPKLGPFHHRSPSDVFIRT
VRSMLPRYTKRGQRALRQLVAYEGVPVNVVRTGGRVVIPKAQRHNCYRNE
RRFTVLGNMCKHVGWKYSDVVEKLEAARIEKSGRHHKKMEKVRVAWKNAR
KEALKKMPQKNVEVLKKFGLA
Ligand information
>8ove Chain BF (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgaaucgccacuucucuuauccggugggcugcccgcccggcgcccagua
ccuucauuuucacaagauc
.......<<<.............<<<<<<<.>>>>>>>.>>>........
...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R11 F17 K19 H20 K30 R55 V131 R132 G134 R136 H145 R179 H187 R194 W197 R201 K211
Binding residue
(residue number reindexed from 1)		R10 F16 K18 H19 K29 R54 V130 R131 G133 R135 H144 R178 H186 R193 W196 R200 K210
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ585J5

[Back to BioLiP]