Structure of PDB 7nqh Chain BL Binding Site BS03

Receptor Information
>7nqh Chain BL (length=250) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLILEVTAGVGGQEAMLFTSEIFDMYQQYAAFKRWHFETLEYFPSELGGL
RHASASIGGSEAYRHMKFEGGVHRVQRVPKTEKQGRVHTSTMTVAILPQP
TEINLVINPKDLRIDTKRASGAGGQHVNTTDSAVRIVHLPTGVVSECQQE
RSQLKNKELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTY
NFPQNRVTDHRINKTLHDLETFMQGDYLLDELVQSLKEYADYESLVEIIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		G113 Q115 Q178 G187 R188 V189 H190 T191
Binding residue
(residue number reindexed from 1)		G11 Q13 Q76 G85 R86 V87 H88 T89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0016149 translation release factor activity, codon specific
Biological Process
GO:0006412 translation
GO:0006415 translational termination
GO:0070126 mitochondrial translational termination
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nqh, PDBe:7nqh, PDBj:7nqh
PDBsum7nqh
PubMed33878294
UniProtQ9UGC7|RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial (Gene Name=MTRF1L)

[Back to BioLiP]