Structure of PDB 4ujc Chain BI Binding Site BS03

Receptor Information
>4ujc Chain BI (length=196) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHM
VSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKM
FGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHIS
KKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKWRALHS
Ligand information
>4ujc Chain A4 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcu
.<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
>>....>>>>>>.>>.<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>.>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ujc Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.
Resolution9.5 Å
Binding residue
(original residue number in PDB)
Y11 E56 Y57 N202 R203 G204 P205 L206
Binding residue
(residue number reindexed from 1)
Y9 E54 Y55 N184 R185 G186 P187 L188
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat May 3 08:46:58 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4ujc', asym_id = 'BI', bs = 'BS03', title = 'Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4ujc', asym_id='BI', bs='BS03', title='Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ujc', asym_id = 'BI'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ujc', asym_id='BI')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>