Structure of PDB 7lh5 Chain BG Binding Site BS03

Receptor Information

>7lh5 Chain BG (length=178) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARIL
EKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALR
GMDIAVVTTAETDEEARALLELLGFPFR

Ligand information

>7lh5 Chain BB (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7lh5 Structural basis for plazomicin antibiotic action and resistance.
Resolution	3.27 Å
Binding residue (original residue number in PDB)	N27 W29 E30 Q66 K67 A69 V70 R72 V92 T93 R95 R96 R98
Binding residue (residue number reindexed from 1)	N24 W26 E27 Q63 K64 A66 V67 R69 V89 T90 R92 R93 R95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
PDBsum	7lh5
PubMed	34117352
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]