Structure of PDB 9axy Chain B Binding Site BS03

Receptor Information
>9axy Chain B (length=312) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKP
SGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEI
SICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHR
DVKPSNILVNSRGEIKLCDFGVSGQLIDAMANAFVGTRSYMSPERLQGTH
YSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMPMAIFELLDYIVNEP
PPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDF
AGWLCSTIGLNQ
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0
[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain9axy Chain B Residue 403 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9axy The pan-RAF-MEK non degrading molecular glue NST-628 is a potent and brain penetrant inhibitor of the RAS-MAPK pathway with activity across diverse RAS- and RAF-driven cancers.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
N195 D208
Binding residue
(residue number reindexed from 1)
N156 D169
Annotation score1
Enzymatic activity
Enzyme Commision number 2.7.12.2: mitogen-activated protein kinase kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004708 MAP kinase kinase activity
GO:0004712 protein serine/threonine/tyrosine kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005078 MAP-kinase scaffold activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030295 protein kinase activator activity
GO:0043539 protein serine/threonine kinase activator activity
GO:0097110 scaffold protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0006468 protein phosphorylation
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0007507 heart development
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0014044 Schwann cell development
GO:0016310 phosphorylation
GO:0021697 cerebellar cortex formation
GO:0030182 neuron differentiation
GO:0030216 keratinocyte differentiation
GO:0030878 thyroid gland development
GO:0032872 regulation of stress-activated MAPK cascade
GO:0035987 endodermal cell differentiation
GO:0038133 ERBB2-ERBB3 signaling pathway
GO:0042552 myelination
GO:0043410 positive regulation of MAPK cascade
GO:0044342 type B pancreatic cell proliferation
GO:0045893 positive regulation of DNA-templated transcription
GO:0048009 insulin-like growth factor receptor signaling pathway
GO:0048538 thymus development
GO:0048679 regulation of axon regeneration
GO:0048870 cell motility
GO:0050772 positive regulation of axonogenesis
GO:0060020 Bergmann glial cell differentiation
GO:0060324 face development
GO:0060425 lung morphogenesis
GO:0060440 trachea formation
GO:0060502 epithelial cell proliferation involved in lung morphogenesis
GO:0060674 placenta blood vessel development
GO:0060711 labyrinthine layer development
GO:0070371 ERK1 and ERK2 cascade
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0090170 regulation of Golgi inheritance
GO:0090398 cellular senescence
GO:1903226 positive regulation of endodermal cell differentiation
GO:2000641 regulation of early endosome to late endosome transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005816 spindle pole body
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:9axy, PDBe:9axy, PDBj:9axy
PDBsum9axy
PubMed38588399
UniProtQ02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 (Gene Name=MAP2K1)

[Back to BioLiP]