Structure of PDB 8rpx Chain B Binding Site BS03

Receptor Information

>8rpx Chain B (length=156) Species: 1206749 (Nitrolancea hollandica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LENLTTRELLAVSRASLRELKRRGVIRSGNAPAGDYAELLVQRATDGELA
NASQKSWDIRTTEGDRLQVKARVITDEHANGERQLSTIRSWDFDAAVIVL
FDDNFRVWRAARVPAAIMKEAAYYSQHVRGYTVYAKDALLNHSEVEDWTE
QLRSVE

Ligand information

>8rpx Chain H (length=9) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgcagctc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8rpx Structural analysis of the BisI family of modification dependent restriction endonucleases
Resolution	1.81 Å
Binding residue (original residue number in PDB)	N92 Y146
Binding residue (residue number reindexed from 1)	N80 Y134

External links

PDB	RCSB:8rpx, PDBe:8rpx, PDBj:8rpx
PDBsum	8rpx
PubMed	39041409
UniProt	I4EG67

[Back to BioLiP]