Structure of PDB 8rct Chain B Binding Site BS03

Receptor Information

>8rct Chain B (length=233) Species: 562 (Escherichia coli)

ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFN
EALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGML
TNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGI
KDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIP
GNDDAIRAVTLYLGAVAATVREGRSQDLASQAE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8rct Chain B Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
• Resolution: 5.32 Å
• Binding residue (original residue number in PDB): H18 D188
• Binding residue (residue number reindexed from 1): H17 D187
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rct, PDBe:8rct, PDBj:8rct
• PDBsum: 8rct
• PubMed: 38409277
• UniProt: P0A7V0|RS2_ECOLI Small ribosomal subunit protein uS2 (Gene Name=rpsB)