Structure of PDB 8rcs Chain B Binding Site BS03

Receptor Information
>8rcs Chain B (length=233) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFN
EALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGML
TNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGI
KDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIP
GNDDAIRAVTLYLGAVAATVREGRSQDLASQAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rcs Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
Resolution4.46 Å
Binding residue
(original residue number in PDB)		R7 R35 L43
Binding residue
(residue number reindexed from 1)		R6 R34 L42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008270 zinc ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rcs, PDBe:8rcs, PDBj:8rcs
PDBsum8rcs
PubMed38409277
UniProtP0A7V0|RS2_ECOLI Small ribosomal subunit protein uS2 (Gene Name=rpsB)

[Back to BioLiP]