Structure of PDB 8q9p Chain B Binding Site BS03

Receptor Information
>8q9p Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q9p Folding of Class IIa HDAC Derived Peptides into alpha-helices Upon Binding to Myocyte Enhancer Factor-2 in Complex with DNA.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G2 R3 K5 K31
Binding residue
(residue number reindexed from 1)		G1 R2 K4 K30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8q9p, PDBe:8q9p, PDBj:8q9p
PDBsum8q9p
PubMed38492719
UniProtQ05BX2

[Back to BioLiP]