Structure of PDB 8k29 Chain B Binding Site BS03

Receptor Information
>8k29 Chain B (length=246) Species: 979527 (Vibrio phage ICP1_2004_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRKFIIVKNVKVDGINAKSSDITVGMPPATTFCGLGETMSIKTGIVVKAV
SYGSVKFEVRGSRFNTSVTKFAWQDRGNGGKANNNSPIQPKPLADGVFTL
CFEVEWEDCAEVLVDKVTNFINTARIAGGTIASFNKPFVKVAKDAEELAS
VKNAMMPCYVVVDCGVEVNIFEDAVNRKLQPMVNGYKKLEKIVDNKHMRD
KFTPAYLATPTYTMIGYKMVSNVDNFDQALWQYGENTKVKTIGGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k29 Structure of csy complex with long DNA State2
Resolution3.18 Å
Binding residue
(original residue number in PDB)		R63 F64 N153 M156 P157 Y159 Y217 K218 M219 S221 N222
Binding residue
(residue number reindexed from 1)		R63 F64 N153 M156 P157 Y159 Y217 K218 M219 S221 N222
External links